Peptide Hormones
Mostrando 25-36 de 239 artigos, teses e dissertações.
-
25. Purificação e caracterização da insulina e de peptideos derivados do proglucagon e prossomatostatina isoladaos do, peixe frugivoro, pacu Piaractus mesopotamicus Holmberg, 1887 (Teleostei, Characidae Serrasalminae)
The fruit-eating teleost fish, the pacu Piaractus mesopotamicus Holmberg, 1887 (Characiformes, Characidae, Serrasalminae), similarly to tambaqui Colossoma macropomum, is classified with the carp and the catfish in the superorder Ostariophysi. The pacu and tambaqui have the pancreatic tissue exibiting both principal islet and small Brockmann bodies (Bbs). The
Publicado em: 1998
-
26. Parathyrin and calcitonin stimulate cyclic AMP accumulation in cultured murine brain cells.
Despite the key role Ca2+ plays in the nervous system, biochemical actions on neural tissue of the Ca2+-regulating peptide hormones parathyrin and calcitonin were unknown. Until a few years ago only neurons, but not glial cells, were considered as targets for peptide hormones. Our recent observation that peptide hormones do indeed act on glial cells is exten
-
27. Progress toward hormonal therapy of gastrointestinal cancer.
OBJECTIVE: The authors discuss ongoing research to determine the mechanisms by which peptide hormones regulate growth of gastrointestinal cancer and ways in which this information might be used to develop noncytotoxic therapy. SUMMARY BACKGROUND: Approximately 100,000 people die of cancer of the gastrointestinal (GI) tract each year. Surgery is curative only
-
28. Isolation and identification of a diuretic hormone from the mealworm Tenebrio molitor.
A diuretic hormone of unusual structure was isolated from extracts of whole heads of the mealworm Tenebrio molitor. The hormone is a 37-aa peptide of 4371 Da, with the sequence SPTISITAPIDVLRKTWEQERARKQMVKNREFLNSLN. This peptide increases cAMP production in Malpighian tubules of T. molitor. The amino acid sequence reveals that this peptide is a member of the
-
29. Isolation and characterization of the intestinal peptide porcine PHI (PHI-27), a new member of the glucagon--secretin family.
A new peptide, designated PHI (PHI-27), has been discovered and isolated from porcine upper intestinal tissue by using a chemical method for finding peptide hormones and other active peptides. The method is based on chemical detection of peptides having the cOOH-terminal alpha-amide structure, which is an unusual chemical feature of some peptide hormones and
-
30. Sequences of Pituitary and Placental Lactogenic and Growth Hormones: Evolution from a Primordial Peptide by Gene Reduplication
Human placental lactogen has been found to resemble human pituitary growth hormone very closely in amino acid sequence, about 80% of the residues examined being identical in the two molecules when a revised sequence for growth hormone is used as the basis for comparison. The structural features responsible for the differing biological potency of the two horm
-
31. ENZYMATIC INACTIVATION OF PEPTIDE HORMONES POSSESSING A C-TERMINAL AMIDE GROUP*
A partially purified enzyme extracted from the bladder of the toad, Bufo marinus L., was found to cleave the glycine amide moiety from oxytocin, 8-lysine-vasopressin, 8-arginine-vasopressin, and other hormone analogs terminating in a primary carboxamide group; however, this enzyme does not attack hormone analogs terminating with a methylamide, dimethylamide,
-
32. Skeletal overgrowth in transgenic mice that overexpress brain natriuretic peptide
Longitudinal bone growth is determined by the process of endochondral ossification in the cartilaginous growth plate, which is located at both ends of vertebrae and long bones and involves many systemic hormones and local regulators. Natriuretic peptides organize a family of three structurally related peptides: atrial natriuretic peptide, brain natriuretic p
The National Academy of Sciences.
-
33. Chemical determination of polypeptide hormones.
The presence or absence of peptide hormones in tissue extracts may in certain cases be demonstrated by exposing the extracts to conditions under which characteristic fragments of the polypeptide molecule in question are formed and then analyzing for such fragments. An approximate quantitation of the hormones may also be achieved thereby. In the present work
-
34. Effects of Meals High in Carbohydrate, Protein, and Fat on Ghrelin and Peptide YY Secretion in Prepubertal Children
Context: Ghrelin and peptide YY (PYY) are two hormones produced by the gastrointestinal tract that have effects on appetite. However, little is known about their secretion in response to meals high in individual macronutrients in prepubertal children.
The Endocrine Society.
-
35. A receptor-binding region in human choriogonadotropin/lutropin beta subunit.
Synthetic fragments have not been widely used thus far to evaluate structure-activity relations in the glycoprotein hormones. We prepared a series of peptides representing the intercysteine "loop" sequence (residues 38-57) in human choriogonadotropin (hCG) and lutropin (hLH) beta subunits, anticipating that it might be oriented toward the surface and accessi
-
36. Chromogranin A Promotes Peptide Hormone Sorting to Mobile Granules in Constitutively and Regulated Secreting Cells: ROLE OF CONSERVED N- AND C-TERMINAL PEPTIDES*S⃞
Chromogranin A (CgA) has been proposed to play a major role in the formation of dense-core secretory granules (DCGs) in neuroendocrine cells. Here, we took advantage of unique features of the frog CgA (fCgA) to assess the role of this granin and its potential functional determinants in hormone sorting during DCG biogenesis. Expression of fCgA in the cons
American Society for Biochemistry and Molecular Biology.